DPCstruct | MC13220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 18.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136H8A2 | 9-132 | IANRYAEGVVSGLINECKYVVLACQRHLSDINKSNSKEFNYWFDENSAAAACESIQQYKHKKGLWARKNLTLKLQPWQLFQLVSVFG… |
| A0A6M1CMA6 | 1-116 | TRAERNILWCERNIYIPEGKFVGQPLKMAEFMKDDFRAIFDNKHGTRRAIISRGRKNAKTVETAMLMLLYLVGPEAAPNSQLYSAAR… |
| A0A377ZHC1 | 5-122 | None |
| A0A380DKS4 | 2-118 | None |
| A0A198FB69 | 6-162 | None |
| R9IVY1 | 17-140 | None |
| A0A0F9EY70 | 6-149 | None |
| A0A2G4IMA1 | 14-151 | None |
| A0A839PBE5 | 2-141 | None |
| A0A1X7SMQ9 | 8-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.