DPCstruct | MC13218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I0VCH0 | 2-117 | EYTKHGNNAALSIHVLDDTAMRALGFTDCVPEDWYLCRPVSDDRTTSLDVTAAKDGSDWRIDVLDEDFGQPYDYQWLLSQNPDLAYA… |
| A0A496M2D5 | 3-95 | ELFEKYKSNPNKLQTYGFKESDGVYHFSQKIMKGDFRLEVTIRDGKLDYQVFDCDTDDTYLQVKMEQVTGEFVGQVREACQAALLAI… |
| A0A4Y9FDX1 | 5-100 | None |
| A0A4R5N583 | 6-94 | None |
| A0A833FID7 | 6-96 | None |
| A0A1C5NH46 | 3-107 | None |
| R5WGC3 | 5-92 | None |
| F4LLW1 | 2-96 | None |
| R9LTE7 | 1-90 | None |
| A0A316LL57 | 1-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.