DPCstruct | MC13217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 129 ± 26 aa |
| Standard deviation of domain lengths | 25.50 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357NLV5 | 34-166 | FPTLRVALPVPLPQLFDYAPPPGTAAVPGQVGCRVRVPFGARELIGMVAAVGAVDSPDSLREAQAWIDPQPLLDGELWASLQWLARY… |
| A0A496LRM1 | 2-135 | KVAKVIVDVPLMQTDKPYSYAVPEEFSGMLEAGMRVHVPFGKGGRLIQGLIVGLADEKAEDLAGHIGELKDIAEVLDFRPVLNAEQL… |
| A0A0K2RTT3 | 7-139 | None |
| A0A7V6KW68 | 7-153 | None |
| K2DVJ6 | 2-107 | None |
| A0A2V7KMN8 | 320-495 | None |
| A0A7V3AEY9 | 209-340 | None |
| A0A136N8C6 | 3-136 | None |
| F2I3J1 | 1-98 | None |
| A0A220VCM1 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.