DPCstruct | MC13215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496LB29 | 3-104 | KEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNFDIRLVQPNEDSIPTAGLHTIEHLLAMLIRKRIDGMIDCSPFGCRTGFHMI… |
| A0A828R0A9 | 1-92 | MEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLFAGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRV… |
| A0A397LYD7 | 1-100 | None |
| A0A533ZWU3 | 15-112 | None |
| A0A1V6FT45 | 1-107 | None |
| A0A8A6R6A7 | 1-107 | None |
| A0A1H2Q6Z7 | 2-110 | None |
| U2QHX9 | 1-110 | None |
| A0A533IF47 | 1-113 | None |
| A0A654DT86 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.