DPCstruct | MC13214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 131 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060RI21 | 161-289 | LPINLKIVMGFHTEFILDSQGRFANEIDPQGTNHNGIINGASFNYANQNDKRHYELDIAPIKPHDPAFRKQILANQGNRFSAPLLIK… |
| A0A496L8W8 | 1-128 | LLNFHTEFILDNEGHFLNEIDAEHITQNGIINGASFNYANSGNQRHWELDVNPTKSHDPLFRDAAIATKDLRFTAPKYILKKIEAAS… |
| G5JV05 | 280-410 | None |
| A0A3P1VJX3 | 160-287 | None |
| A0A1Q8RH01 | 215-341 | None |
| G5JNA2 | 83-228 | None |
| G5JN99 | 28-166 | None |
| A0A7G1JT27 | 122-243 | None |
| A0A0E4CSN8 | 129-256 | None |
| A0A116P4G0 | 13-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.