DPCstruct | MC13213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 823 ± 120 aa |
| Standard deviation of domain lengths | 120.25 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 77.50 |
| Assigned Pfam label(s) | CL0535- CL0036- CL0155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0HIP1 | 1-759 | MGIPGSSHGHENNVVACFYESWSVYRPELGQFNIDDIDANLCTHISFCYLGLNEHTSTIMEIDEYAIQQGALQKLVALKEKNPSLKV… |
| A0A182NTI3 | 4-680 | NKHVFGVFDATAADRIGKGKCDVDGINPNLCTHLIYAHVELNKAGSIVRLPTYDGKHAMRRFNDLRDQGNRRLKTLVSIGDPNMATC… |
| A0A401NNQ5 | 242-889 | None |
| A0A418YIH7 | 9-952 | None |
| A0A813RXS6 | 23-1044 | None |
| A0A7R9CCT7 | 108-1062 | None |
| A0A482XCY9 | 462-1208 | None |
| A0A5J5A0L7 | 21-797 | None |
| A0A6A5HD50 | 5-784 | None |
| A0A336LSL7 | 348-1125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.