DPCstruct | MC13212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 110 ± 5 aa |
| Standard deviation of domain lengths | 5.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7ZH33 | 31-141 | PDTSPRGCNIKGEDESWDFGTGAGFYVDATEHPWKTNYRMYSYVTEELPQLINANFPVDPQRMSIFGHSMGGHGALICALKNPGKYK… |
| A0A6A0HEY8 | 18-139 | VPPQHAEGDCKIEGEDADYDFGTGAGFYVDATAEPWKTNYRMYSYVTQELPVLIAANFNIIPGKTGIMGHSMGGHGALVCALKKTGQ… |
| A0A813BC34 | 237-345 | None |
| A0A090RA02 | 82-193 | None |
| A0A3D0W959 | 81-191 | None |
| A0A377XRE4 | 1-112 | None |
| A0A7S4QM50 | 87-196 | None |
| A0A4S4EDW9 | 133-229 | None |
| A0A5N6KYL5 | 89-199 | None |
| A0A1M3N191 | 53-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.