DPCstruct | MC13208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 271 |
|---|---|
| Mean domain length (aa) | 155 ± 35 aa |
| Standard deviation of domain lengths | 34.97 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 80.23 |
| Assigned Pfam label(s) | CL0063- CL0129- CL0442- CL0236- CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0NPP5 | 1-117 | RYLACGLLLRGDVTASEAQRALARLRPQLQLSHWNPDSFKVGLCGAAPVGQPHSVLSLSNNCCMASLFRGLLERFQRLYRRRAHVHH… |
| A0A6A0H8S3 | 51-216 | RRSSFSAPSSAPSTSSSTSSTSPMWSGPLSPGVHMACCLMYRGQVKPSDVTTAIKKVIQKRAINFVSWTPTGFKVGVNYQPVTTLPE… |
| A0A0C2JKT5 | 1-122 | None |
| A0A5S6QE49 | 269-438 | None |
| A0A5S6QB43 | 42-201 | None |
| A0A1L9TVE9 | 6-97 | None |
| A0A6J0N6F2 | 64-194 | None |
| A0A7S4UCJ9 | 106-268 | None |
| A0A2B4STP4 | 856-1003 | None |
| A0A061RP97 | 21-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.