DPCstruct | MC13206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 45 ± 2 aa |
| Standard deviation of domain lengths | 1.54 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 87.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0JB06 | 28-72 | NKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV |
| A0A820RGI1 | 15-59 | NKAAIMKYENNIVNIRQFNCSPHPYWLPNFMDVFSWSLPFVGEKV |
| T1K363 | 46-90 | None |
| A0A834K3U4 | 71-115 | None |
| A0A821HVU1 | 70-111 | None |
| A0A095A1V2 | 28-72 | None |
| A0A183L620 | 1-48 | None |
| A0A5B7EBT1 | 129-173 | None |
| A0A0T6BHC7 | 28-72 | None |
| A0A167T5M2 | 19-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.