DPCstruct | MC13203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 137 ± 37 aa |
| Standard deviation of domain lengths | 37.33 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3KQH1 | 73-179 | KNLVLVDELDSLSPILFCQMADLANEDTPQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFV… |
| A0A6A0H1G2 | 1-134 | MDSLLNIGPCGDMGVGEPAFLSEEYDCSVDPCVEIVTTSGHGKNGALSVLQRAIKPQVLTTFELPGVNKMWTVFGSANADGGRRKAI… |
| A0A2K0UHN6 | 310-472 | None |
| A0A3Q0JJT0 | 26-160 | None |
| A0A1I8IQL2 | 835-961 | None |
| A0A397FBJ6 | 860-945 | None |
| A0A6I9YKR5 | 192-398 | None |
| A0A803KTF9 | 451-568 | None |
| A0A7R9B6L2 | 198-328 | None |
| A0A453BKP6 | 480-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.