DPCstruct | MC13201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9REV0 | 178-272 | LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWT… |
| A0A6A0GZL5 | 1-89 | MGVILYHKFQDAFFSGQELHPPPDTFTLFHYNGLPASNPDKKVQYAKGYVTRQETLVPFDSLHDLTACLSSKWPNIELQWEANFKPS… |
| A0A182T0Y5 | 138-232 | None |
| U4UXQ6 | 862-955 | None |
| A0A3S1BEU4 | 87-170 | None |
| A0A7M3RNQ8 | 676-774 | None |
| A0A5E4PMK9 | 544-636 | None |
| A0A5J4N8E2 | 318-411 | None |
| A0A7D9L830 | 70-173 | None |
| A0A444U1Y6 | 199-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.