DPCstruct | MC13200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 216 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00057- PF02931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VXJ7 | 33-249 | ARCDEQQCVVCAVPRRPVWKLLGACERYHRNTHFVALQDPSEGFLFRGYSDYRIVRDGSQWLWWDWRNSQTVATLSSGVNGVPIGRQ… |
| A0A0P4VR73 | 273-476 | PRRPVWKLLGACERYHRNTHFVALQDPSEGFLFRGYSDYRIVRDGSQWLWWDWRNSQTVATLSSGVNGVPIGRQDWRLTRPMCGQTE… |
| A0A0P4WCH5 | 149-373 | None |
| A0A0P4WEH7 | 196-421 | None |
| A0A3R7PQ40 | 604-839 | None |
| A0A0N7ZCC6 | 286-518 | None |
| A0A7R8D5S4 | 4-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.