DPCstruct | MC1320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226WMQ8 | 3-82 | RIIATFHPQTWVERKRVDVEPLGEGSFDVTDFLRELGEVAARKIRDYDDSSDDLASLPSAPEWIRSWPGPFFVTVEQSID |
| A0A3M3DPT2 | 20-108 | SASDSQRIFVMFYPEVWIQDNATLADPGETQIDVTAEILDMGMLTALKLKDNDYPSDDLRLGVETPQWVKDWPGPHRVSCECAIREH… |
| A0A240UHT5 | 67-153 | None |
| A0A854G409 | 162-250 | None |
| A0A4V3ET20 | 240-304 | None |
| A0A6G6J8N8 | 142-232 | None |
| A0A258KY47 | 88-180 | None |
| A0A523A119 | 15-101 | None |
| A0A420RSM0 | 58-137 | None |
| A0A024J1N2 | 118-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.