DPCstruct | MC132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836T891 | 37-120 | ADNEAKIQQAVAMLVRVINDTSVPRNIRRAATEAIKHLKEPSLSPGVRAANAVGVLDEVSQDPNMPVYARITLWNVVTLLETVK |
| A0A842TKT2 | 34-116 | IDPEETIQQIVQLLAQVCNNSSVPRNIRRAADEAIQILESDKGTPAHKASNAISILDEISQDPNCPLYARTKIWNTVSLLETI |
| A0A1Q9MR61 | 13-95 | None |
| A0A842SRN0 | 4-82 | None |
| A0A256ZYB8 | 3-80 | None |
| A0A842W5D0 | 2-82 | None |
| A0A7K4A7S2 | 6-85 | None |
| A0A7J2TA40 | 26-109 | None |
| A0A1Q9N6K0 | 1-73 | None |
| A0A7C2V4A5 | 7-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.