DPCstruct | MC13199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 264 |
|---|---|
| Mean domain length (aa) | 147 ± 24 aa |
| Standard deviation of domain lengths | 23.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 99.03 |
| Assigned Pfam label(s) | CL0139- CL0055- CL0028- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0ISF9 | 20-160 | YTQGGLAWNGKWGSLRTTANTAFLAGVYHDTVDNDSRYHSFTQKQIDYILGDNPRNSSYVVGFGNNSPENPHHRAASGLEKINASED… |
| A0A6A0GZ91 | 14-149 | WGSLSSATQIAFIALKAGKAADLGIEPEVNRAWAEQQINYALGSSGRSYLIGYGDNYPLRPHHRGSSCLDLPEVCDDGWALNQPGPN… |
| E4XPX2 | 1123-1261 | None |
| A0A383W5M1 | 12-291 | None |
| A0A383W1B7 | 45-216 | None |
| A0A1E5V4J6 | 281-433 | None |
| A2Y000 | 109-268 | None |
| A2X0Y7 | 50-231 | None |
| A0A7R9AR00 | 553-707 | None |
| A0A3B9IW87 | 311-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.