DPCstruct | MC13198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 188 ± 30 aa |
| Standard deviation of domain lengths | 30.37 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182SU76 | 1-183 | EREKNDPTGFRDAVIAGLEAAEDLEQIYKYLDSAGNKLDYRRYGEVLFDILIAGGLLVPGGSISQDGEKPRTDRCIFAASEDMESMR… |
| A0A6A0GYU8 | 1-146 | MSTKAEKPVLQGQRIKTRKRDEKAKFDPIGFRDNILQGFAGIGGSDIEAIHKYLDAAGSKLDYRTYGEALFDILLAGGILAPGGAVS… |
| A0A0D2MRD5 | 1-158 | None |
| A0A7G2E065 | 176-377 | None |
| A0A816KEH4 | 58-252 | None |
| A0A1J1IHR8 | 231-434 | None |
| A0A3Q2IEI4 | 13-225 | None |
| A0A4W3HGL5 | 3-163 | None |
| A0A540K4A5 | 4-188 | None |
| A0A3Q0J541 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.