DPCstruct | MC13195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 270 ± 33 aa |
| Standard deviation of domain lengths | 33.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0GVG8 | 3-233 | DRNTVIFSKERLYAASCGHVNSSSAHQDNNTIELLNSNLGWKNKAKVAFIFCTYVKHQNGNKFYDLVMEDCFNGTVGDANRVQNVTD… |
| A0A553PPN7 | 286-553 | YECRNGYCSEIYDLVCERRCDSRMFSTLLKNSMLFIGERVIMAECSKRSTVNVSSLDEGDTRSETLMIACTNVTIDREARTMISQDC… |
| A0A6P4GJJ7 | 2-214 | None |
| A0A2S2PSD4 | 157-471 | None |
| A0A482VY29 | 756-1042 | None |
| A0A1A9UG49 | 39-323 | None |
| U4UVP8 | 415-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.