DPCstruct | MC13194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 205 ± 26 aa |
| Standard deviation of domain lengths | 26.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7UFA9 | 1-212 | MAAPTTDQFDGWLGQKLTCLNPEVDLDVFVEYIKGILETETEEEDVVESMSGILSEITEESETLTQCKVIFEEWNRCLGSEAEKLKN… |
| A0A6A0GU40 | 1-191 | MSSESLPLDFDIYLKETLINLKTDDEIFSPYIKGILEGDESPEDKNEALQGIISEITDSGIEAICEDILKKWSSCSGKNSCNCESQP… |
| A0A6S7GUC8 | 1-225 | None |
| A0A6P8HGC0 | 1-224 | None |
| T1JD44 | 1-184 | None |
| A0A5N5MH61 | 1-163 | None |
| A0A812EQ01 | 1-176 | None |
| A0A1V9X538 | 53-299 | None |
| A0A6P3EXN6 | 78-268 | None |
| A0A7M7JFH9 | 2-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.