DPCstruct | MC13193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0GTC0 | 1-69 | MQTGGLIDHGHHGNKAHKALSETLELDAAVSAALEMVCLQETLVIVTADHGHSMSLNGYPGRHTDVLGL |
| A0A183L3X9 | 103-173 | FLLLVEGGKIDHGNHDNRAQYALTETLELEKAVEKALSLVDQQETLLLVTADHSHAYGVVGYPTRNTSVLD |
| A0A2A3EKY6 | 232-298 | None |
| A0A4Y2TJS9 | 51-128 | None |
| A0A7R9BAV4 | 33-106 | None |
| A0A7M3VJT7 | 134-206 | None |
| E9I920 | 1-86 | None |
| A0A444T9F7 | 11-78 | None |
| A0A0L8GVT5 | 73-137 | None |
| A0A7R9HXC4 | 115-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.