DPCstruct | MC13191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Standard deviation of domain lengths | 21.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16704- PF01465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8RCA0 | 2-111 | QKLSSTTKSADHLNGLLRETEATNAVLTEQIKLLKSEIRRLERNQQREKSLANLEYLKNVLLQFIFLKPGSERERLLPVIDTMLQLS… |
| A0A6A0GR35 | 181-310 | AEGEAMVKSYELDAYEVRMEQVTVLLHESEAENAKLSQLTDALKEEIRRGSRNHDREKHLENLEYLKNVVLQFITLGDSGSDGRERL… |
| A0A7R9LDC2 | 36-176 | None |
| A0A183N037 | 1-189 | None |
| A0A132AJK1 | 385-503 | None |
| A0A6P4YTJ7 | 12-189 | None |
| A0A0K8R2T9 | 91-215 | None |
| K1PL07 | 1123-1274 | None |
| A0A194R8V7 | 5-118 | None |
| A0A2G5UHE2 | 25-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.