DPCstruct | MC13190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 2.73 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084WR08 | 94-155 | HCQASSCRMFCPAGFAKDPASGCPVCRCRDPCEDVQCPRGQQCEPQEVQCKTEPCPPIPTCR |
| A0A7J7AMU2 | 150-211 | CPAFECKLYCKYGYELDSNNCPICKCKNPCQNVTCPKFHYCAVREIFCAKEPCPEPKPYCKS |
| A0A834MAN0 | 71-136 | None |
| A0A5B7JMH8 | 1-64 | None |
| A0A1B0DQ01 | 152-213 | None |
| A0A5N4ACT1 | 93-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.