DPCstruct | MC1319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 51 ± 3 aa |
| Standard deviation of domain lengths | 3.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6X7KAR2 | 15-66 | DPLLEYFEKITEYPDGTDLIYYPETESDGTPEGILNIIKEWRESQGLPCFKK |
| P09881 | 33-84 | DDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQ |
| A0A828IYL7 | 1-56 | None |
| A0A2T6GAR7 | 171-222 | None |
| A0A7H0EV36 | 11-64 | None |
| A0A8B3GJH9 | 81-131 | None |
| A0A2N8BIE0 | 14-65 | None |
| A0A509MPH3 | 32-81 | None |
| A0A173IZS7 | 2-45 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.