DPCstruct | MC13189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 119 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.53 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF19292- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0GQ83 | 8-133 | LLNFHSFIETKTNFCLTTSQVRCLILLIYSELQIVRLLKGSYGFKRFERDGFGSVLEDKTRRHYHKGETKVSLLTLLPHQEFEGVEC… |
| A0A0C9RCU4 | 161-281 | MLPRESSSKSVDSALLPTISFPAFATHEEYLYNETKSNVVRKLKGSYGFKRFGRDGYKTVIEDPERRFYRTGEIRDFDKIECEWPLF… |
| A0A1S3MTL0 | 161-285 | None |
| A0A5J5CLW7 | 159-279 | None |
| A0A2C9JLV8 | 305-429 | None |
| A0A067RWI8 | 245-369 | None |
| A0A183QAI7 | 10-121 | None |
| A0A5K3EH41 | 242-362 | None |
| A0A5K3EIZ4 | 14-149 | None |
| G3PPZ1 | 275-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.