DPCstruct | MC13188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10256 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A0GQ19 | 11-80 | ASPPQGCMKVFIQRDYSEGTSVKFQTKFPQELNGKVFFIWAIEPSIFEQMLNTVNSMYAEAEQMSCGRYC |
| A0A4W5K9R8 | 15-67 | ANKVFLQRDYSEGTTCRFQTKFPSELESRIERTLFEDTVKTLNNYYAEAEKMG |
| A0A7J6CLS0 | 1-69 | None |
| A0A6A5FHB0 | 12-80 | None |
| A0A183RSW4 | 131-194 | None |
| A0A1S3T100 | 2-70 | None |
| G5ALC5 | 1-66 | None |
| A0A7M4F634 | 1-62 | None |
| A0A7R9PVG1 | 102-161 | None |
| A0A2I2UFZ6 | 58-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.