DPCstruct | MC13186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8E6J6 | 1-176 | MPHRRFDDVHEEGDVRDGERRWCEVFARVWEALVNQPLGSTFQLPVEDGHSLAFEHVGLQATVRNSLERNFLMRIAKLLGYVSDEPT… |
| A0A2D7VJK9 | 64-221 | EVRMLRERLERNNLQRRVRRFTVLLPRLWGVLLRRPLGERMTFTAMTRGRPNVSFDGCDAQFETASMVERRALYAMLEASGWIRDRE… |
| A0A075G4S4 | 291-455 | None |
| A0A2D8M6N7 | 531-725 | None |
| A0A7C7TXV0 | 654-800 | None |
| A0A6V8ESM6 | 155-311 | None |
| A0A842PDN4 | 6-164 | None |
| A0A367I3H6 | 71-207 | None |
| A0A7J4M8V1 | 120-266 | None |
| A0A7J4R2M5 | 285-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.