DPCstruct | MC13183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 4.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0LPP6 | 1-71 | MLVLGGATRGGRVLGRWPTLDRAARFEGRDLAVTSDFRGLLSEILAGHLALGDTEQVFPGFQRSGGVGVME |
| A0A257IRC9 | 113-185 | FVLGGAVRGGQVIADWPGLAPAQRNEGRDLRITTDLRAVFKTVLAQHLGVPEARLSREVLPGSAGLGLLPLLK |
| A0A1Y6D533 | 373-442 | None |
| A0A661G4Z2 | 33-103 | None |
| A0A530M3W6 | 18-91 | None |
| A0A1Q5S837 | 27-104 | None |
| A0A4U0QSD1 | 371-443 | None |
| A0A7W0ZP27 | 1-61 | None |
| A0A848WCK6 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.