DPCstruct | MC13182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 90 ± 16 aa |
| Standard deviation of domain lengths | 16.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9Y8S0 | 1-62 | WVGVRCESAVAAGREIARGDRVRGMAAAQAEVVHEGVFYDLEVDTTHTESLVCARAIAAKVT |
| A0A7T0WJN3 | 13-91 | TEIRNALFKLLENFKVVCVKVQCSLEVCMAREIARGDRAIGLAEWEYPLVHNHMTYDVTVDTSNVSPKVAARELAQKLG |
| A0A6I4ZLA0 | 5-70 | None |
| A0A7W7FTH6 | 1-87 | None |
| A0A6B2U175 | 83-167 | None |
| A0A1E5JYI9 | 23-144 | None |
| A0A0F4JB18 | 47-134 | None |
| A0A2W1LEX0 | 8-97 | None |
| A0A6P2WU95 | 2-73 | None |
| A0A7S4DY18 | 77-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.