DPCstruct | MC13181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 394 ± 54 aa |
| Standard deviation of domain lengths | 53.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 14.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H1MIT9 | 129-565 | RIGGTGMGSKCIAISWKGDPYSVLIPMSEIVRFYYATSTDLAHALFSGAFRHDLHSLINTEKSGYVQAEDNCVLKLRQHLEDEDGWI… |
| A0A099LRN0 | 1-358 | MSGTARLIRIALMDPEARTSFESIHQTMMREYTSNGQYKFWDFSFTPPCLNRTKLEVSGWHDWNSNSFFIWEIRRVEGLPSSMPDEL… |
| A0A485B3I9 | 2-382 | None |
| A0A7R7HN42 | 1-311 | None |
| H8H3H5 | 2-388 | None |
| A0A072XA31 | 130-508 | None |
| A0A0Q0CFL5 | 205-635 | None |
| A0A1B5EWF1 | 60-460 | None |
| A0A6S4W6X2 | 12-293 | None |
| A0A4Q3IGG4 | 168-652 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.