DPCstruct | MC13180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6G581 | 3-75 | FVVVTHPFHALSGQRLEVLFVKRRGGDSVFVCSGGVSGQMTVPRSWTDRGEPAQSHRLSVEGLAELFAVTRAI |
| A0A4R6EYN5 | 54-136 | AGSRRFQVTHPYHPLHLQEFELVLHAQNWHEDRVWFHDANGRLRALPASWTSVVGEDPFNVVAAGRALFRVEELLELGRLIAT |
| A0A1B0FE87 | 2-82 | None |
| A0A651FBU1 | 3-85 | None |
| A0A3D2MJQ5 | 4-88 | None |
| A0A7W1KAY9 | 2-82 | None |
| A0A7T7Z2W3 | 48-142 | None |
| A0A250JEZ8 | 75-162 | None |
| X1FC46 | 15-87 | None |
| Q0RX67 | 26-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.