DPCstruct | MC1318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A011TAT2 | 1-94 | MTDPLLDLVREYRHQIEVFNASPPDMTVEEDDELVALTWGPHYERLCTAPPDATTLEGAVEAVRLVHDEENRYGSQPDLTTNVLRAA… |
| A0A1L3ZBA4 | 23-111 | DPLLEAIVSYRQGVADFTANAPDDRDSADAYAEKSYRPARRVLKAWNAPALTFVGAVSALKMAKDADLNDDSEVVSAMVKAALGYFE… |
| A0A6L9MM32 | 82-177 | None |
| A0A4R1YKR5 | 17-133 | None |
| A0A7Y0AXN6 | 6-127 | None |
| A0A0N1DP87 | 1-109 | None |
| A0A0Q6FRR2 | 1-108 | None |
| A0A7R6WNY0 | 1-105 | None |
| A0A090EF23 | 119-216 | None |
| A0A545ZBY0 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.