DPCstruct | MC13179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 220 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8SBV3 | 2-199 | EEARRIERHFGTSVMEGLDLEPEASYVKGVGKVEFAEFAAWHARGAAVMHVQLRNAHGQRVDLCLFGSQDNVRGFGPSDGFADGWTS… |
| A0A4R6ELT7 | 6-219 | LYLSTAKLDQLLDQESSFFTNITAKIDFKIPFVSGGLSGTTNTRKNIAKMGRLEATLRKKYSIPNFDEIPAESSPVFISFKGRAVRT… |
| A0A543FW59 | 102-318 | None |
| A0A1T5J0K5 | 9-228 | None |
| A0A7W7M7C7 | 1-211 | None |
| A0A6G3ZB05 | 193-431 | None |
| A0A1E7NE90 | 7-174 | None |
| A0A7W9GDZ8 | 28-224 | None |
| A0A7T4F1Q3 | 37-273 | None |
| F2UWZ5 | 13-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.