DPCstruct | MC13178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3XB61 | 50-193 | APADRPKALAPVNTSAACAFDEELYGGLCYRKCALLTYGENPIRTSSWTCCRSHPCGLTNQKGRVGHKILCNGYDIAGDGSCPKVPG… |
| A0A7S2PT61 | 97-258 | LLPSENLHDRNVCSNNEEFYGGMCYRTCSLLTSGAYPIRTSSWTCCQSHPCGLHNQKGEIGTKILCNGFDVDGSGHACPKAPGACYT… |
| A0A812ZW09 | 14-192 | None |
| A0A1Q9D7S8 | 166-341 | None |
| A0A812MTR3 | 282-448 | None |
| A0A1Q9CPG0 | 1-174 | None |
| A0A813JUM0 | 2-207 | None |
| A0A812T8X0 | 42-215 | None |
| A0A7S2NWN0 | 1-130 | None |
| A0A812PY09 | 238-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.