DPCstruct | MC13177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 134 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2RXV1 | 44-183 | AEMLLYGSSDPRELVQQLLTCDGDPSRHNRLSLLSEEFHVCGLATRSHPSLGSVTVIPLAGGYGPKPLNDSVTVSCSHPVIPRTSQF… |
| A0A7S3X8T7 | 1-131 | GVRQPEAIASQLLLSDGDEQRRNRSFLLNGDLKVAGFGLADHPQHGSVCVLVFTSLFATPIDHPVTVECQAEANEEFLQVVDAIPSD… |
| A0A7S2SPY0 | 897-1017 | None |
| A0A7S2RZ24 | 585-702 | None |
| A0A7S0IUQ3 | 462-597 | None |
| A0A7S2GHB5 | 1-160 | None |
| A0A7S2G3N3 | 449-567 | None |
| A0A7S2B9N3 | 1-111 | None |
| A0A7S0I0W3 | 904-1040 | None |
| A0A7S3RU44 | 639-775 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.