DPCstruct | MC13176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812N8W3 | 6-153 | NLVNLVNLVNQELLQDALYGIARNKIYALVAALNPLRTRSSLGCFINILAAATAAHVLSTPGKEVLDYFLVPHGKRQPLLEFLQPAR… |
| A0A7S3WQZ6 | 1-139 | LLYQAYIPTVTRDIIYGWARGAVGNAMDSVMAPETFNMKAVCFGITVFLACIISSPGNEWRGFTLQPKERKLPFNEYFKPVNYMRST… |
| A0A813F7U5 | 96-244 | None |
| A0A812J6P8 | 219-380 | None |
| A0A1Q9D3P0 | 1085-1234 | None |
| A0A813D430 | 61-179 | None |
| A0A7S2LHQ0 | 1-109 | None |
| A0A813B693 | 174-301 | None |
| A0A812MWC7 | 22-136 | None |
| A0A1Q9CL15 | 830-977 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.