DPCstruct | MC13170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 338 ± 75 aa |
| Standard deviation of domain lengths | 75.33 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0528 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7IYJ5 | 54-503 | LNFFDGMPDKATVQKLYDNLIFMRGVETFLSGIPATSIEAIRLGCAEVGAKRASDVVIFDKLMDSDPLFLTGNTDTVYAIATLELDR… |
| A0A2R8C761 | 63-435 | FQRATQAYIWSIPMVSMARWRLSHEEELGAENGQIVFLETYADKIGGLTYNATTPYVLPFIDLAEGPWVLEMPGPDGAVRGAAHDMW… |
| A0A835XF78 | 86-536 | None |
| A0A520DYH5 | 20-356 | None |
| A0A554PAN7 | 78-352 | None |
| A0A1H0A5F4 | 39-409 | None |
| A0A512C063 | 27-376 | None |
| A0A439F0K5 | 2-299 | None |
| A0A5K7Z1P7 | 95-496 | None |
| A0A2W7CPQ8 | 306-757 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.