DPCstruct | MC1317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 34.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4ABK2 | 1-136 | MPAKQPYIDDAHMAELRSLQALKLPLDVSRLVRLCDELNAVYRGECVMAVAMLCRAIKDHCPPVFGQTNFANVVSHTSAQSTRKILE… |
| A0A1L3Z4J7 | 34-204 | ELIDSATDAGLIQFVPDDCYQLTSRAWDRLSTSEPQQASGQQRGEFVDSARIAELRAISNGDFDLSRLVRMCEEINSAWNSGNTISV… |
| A0A7Z6XC45 | 14-165 | None |
| R4PXE9 | 1-143 | None |
| A0A7Z8R9K0 | 153-328 | None |
| A0A1F4PZ10 | 198-359 | None |
| A0A521QP77 | 392-546 | None |
| V7GUH8 | 13-173 | None |
| A0A285DML9 | 64-214 | None |
| A0A7K2KA32 | 247-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.