DPCstruct | MC13168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 249 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6BVB4 | 44-306 | IYTYAKDHFSYFSDYSNPCLACHNPHLARQNKSDVDNPALTAISRPSDHDNLWGDEAGETMKDLADSAGGVYQPPYYFGSTTTHEPG… |
| A0A7C1VWN1 | 91-304 | IWDFAKTNFSSFFKEDSNPCSVCHNVHLAKRNKEHKSDPTYSAISKPSDHFNLWTNTMNDYAPSSYQAPYRYSSGCEPDGGSCNDLT… |
| A0A1G1G544 | 743-974 | None |
| A0A1E7H3E9 | 285-535 | None |
| A0A662RGE5 | 439-686 | None |
| A0A1E7IA50 | 77-352 | None |
| A0A800C818 | 1-262 | None |
| A0A7C2A7W3 | 149-384 | None |
| A0A7C1WRT4 | 1-233 | None |
| A0A496YZ81 | 156-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.