DPCstruct | MC13167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 388 ± 27 aa |
| Standard deviation of domain lengths | 27.43 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3XJJ2 | 108-439 | NQAARQTARQAEAIARFWAWWTDEGMARSSSALAEGDPGRIVADMTGQVEAVAGELSWEFAKGDESMHKLVVTADGDPALRSTARRW… |
| A0A4Q2KDY0 | 101-473 | DDGDEDISTHYDEISYDNVCYRHSIDGEFPYFARAAFFWEKFAAARGKLEKLLDKGKVKAAKKLFETIKAGAVISDSFLFKKGDVYT… |
| R6BN28 | 103-496 | None |
| A0A139K6M5 | 489-889 | None |
| A0A1E3AZU3 | 533-944 | None |
| A0A1Y4TLY2 | 104-495 | None |
| A0A2Z6IBR4 | 489-853 | None |
| A0A2W4IIC8 | 45-424 | None |
| A0A2X0WU19 | 108-492 | None |
| A0A7T9BND7 | 167-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.