DPCstruct | MC13166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 96 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I0STF2 | 1-86 | MQSMYEVVVHEKLERLLGGSRMPAYYQYANEMTAEQYVDAVIKGVLKDPVITFLLRCGRTPVKVVANYLEDAQSCNYALLMEWRNP |
| A0A7Y8V1C8 | 53-143 | DERKKLCKQMNLKSIVFGGRIPNYYRYADQFTPAEYVREVEKQHLYDPVLTFQLKNGFKVRGVLSNYLKYDMASLKYAVLMEWENPD… |
| A0A7V8HKM2 | 121-224 | None |
| A0A1Q7NP39 | 1-77 | None |
| A0A7C1JI88 | 11-158 | None |
| A0A376E5H6 | 1-113 | None |
| A0A812J6H2 | 651-737 | None |
| A0A850GDC4 | 90-179 | None |
| A0A1M7Y3H6 | 9-101 | None |
| A0A063YVT3 | 119-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.