DPCstruct | MC13165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9FII6 | 1-107 | MQAAIQLLQLLLLALPAVVKAEGCVTKACTLDCQPGETCALQMVDCIRAPCPPIQACVDFQECRIYEPDGSDYCADVCAEGRCPKGS… |
| A0A4V6A5B3 | 1-100 | MFKFYGIVLACLVAVALGGPVDVPHSCDKHKCPAGEHCELTPVQCIREPCYPVPTCHADQLIDEPHTCDKHQCPEGKHCELTPIQCI… |
| A0A4X3P7N7 | 11-94 | None |
| M4BPT8 | 1-108 | None |
| M4BPU3 | 37-156 | None |
| A0A226EGQ7 | 4-103 | None |
| A0A662Y1M7 | 47-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.