DPCstruct | MC13164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V6A1M4 | 2-87 | TNKFTKVDWDKLVKEAEEEEEQEKPEGDAAVQKMFQQIYARASDETKRAMMKSYQESGGTVLSTNWEEIKKKKTEIKPPEGMEFRK |
| A0A7S3NCR8 | 209-301 | EFKPSYPTSNPKKKNWEEVDKNVTKEIQNEKPEGDEAMNTLLKQIYQGADEETRRAMIKSYQTSNGTVLSTSWQDVKDKDYEGKDYV… |
| A0A6S7P072 | 405-505 | None |
| A0A7S4DCA9 | 21-130 | None |
| A0A2T6J575 | 156-266 | None |
| A0A7S1FSN7 | 83-195 | None |
| A0A7S1FU25 | 222-334 | None |
| A0A2R7W9B5 | 396-474 | None |
| A0A2P8YU91 | 1-76 | None |
| B7FW73 | 95-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.