DPCstruct | MC13162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 98 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.57 |
| Pfam Score | 65.35 |
| Assigned Pfam label(s) | CL0172- PF04236- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3N6I0 | 219-304 | RDNLLKFASQAHWVIGSPRFKSFIAYGFYKGGFIHSKPPPFDGPKQFIFGAGISKPCSCSQEGFTVCPRCEESFCFECFWDKCHRC |
| A0A4V5ZYX9 | 4-73 | LLAWQFAAPRYQEMIKLAWYKAGYLEEHPAEFVTPEKFCFRFQNLDANCACGELAVFRCSYCVHHCCIDH |
| A0A821PV86 | 26-131 | None |
| A0A6L5DHW7 | 261-390 | None |
| G0NBA8 | 700-828 | None |
| G0NT07 | 11-93 | None |
| A0A2A6C3J6 | 2-73 | None |
| A0A815K606 | 136-218 | None |
| A0A4U5LYJ6 | 117-216 | None |
| A0A1D1W7P2 | 308-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.