DPCstruct | MC13158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8ENB1 | 7-75 | IGRCSFLFFFGIIFDVVGLVLLLIGIFASFTAWDFYIYTGAIIIALSLVFWILWYTGNVEISNKELELI |
| A0A3Q1FU11 | 2-111 | ERVYRGLGRCACSFWLAVAFDVVGLAVLLIGVFANVFFYDLLIYAGAIVIFLSLIWWVFWYSGNIEVPPAELEDDVGLLKKNKGGLS… |
| A0A803JDJ2 | 16-129 | None |
| E7F694 | 4-119 | None |
| A0A4W4G1B3 | 8-144 | None |
| A0A5J5CT40 | 13-141 | None |
| A0A5E4A5I2 | 4-129 | None |
| A0A3Q7R4B5 | 17-118 | None |
| A0A286ZWB4 | 6-138 | None |
| A0A402FQ66 | 4-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.