DPCstruct | MC13156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 19 aa |
| Standard deviation of domain lengths | 19.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q1FPR8 | 10-129 | DTQSDLIIDCSTSPPTLTNTGHNRFCDDWIQAFLNAAERCNPFLLRQILENFKLKAIQDMNSLKRFVRQAEMSHYALFRCCQFLQGC… |
| A0A643CIA1 | 162-280 | QHKSVIIDCSSSQPQFHNAGSNRFCEDWMQAFLNGAEGGNPFLFRQVLENFKLKAIQDTNNLKRFIRQAEMSHYALFKCYMFLKNCG… |
| F4Q6N1 | 469-590 | None |
| A0A2B4RNR7 | 547-645 | None |
| A0A8B6CNT7 | 1-102 | None |
| F1NQI9 | 165-287 | None |
| R7TBW3 | 184-319 | None |
| A0A553PZI3 | 254-376 | None |
| A0A210QTP5 | 268-439 | None |
| A0A833Z9U0 | 49-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.