DPCstruct | MC13150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 235 ± 42 aa |
| Standard deviation of domain lengths | 41.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 65.41 |
| Assigned Pfam label(s) | PF19533- PF13890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M2DAC6 | 15-217 | AHIIDHAHEGPRSLTTFLEQTISKVASQLRGKEPKYKELLSLLYEAEVAIARCVSLRKKFNLDHGTADPSATSSGSGGSHRHASSVS… |
| A0A671PZW3 | 527-734 | MTEDLLEEQSEVLAKLGTSAEGAHLRARMQSACLLSDMESFKAANPGCCLEDFVRWYSPRDYVEEEGADEAGQTVIRGDLSTRMKIP… |
| A0A287HX67 | 310-506 | None |
| A0A287HX72 | 16-198 | None |
| A0A5B8MH94 | 425-631 | None |
| K3WCV3 | 575-764 | None |
| A0A218X8L9 | 705-998 | None |
| A0A6U5MJ65 | 53-295 | None |
| A0A7C9DU82 | 6-263 | None |
| A0A287HXK5 | 8-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.