DPCstruct | MC1315
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 147 ± 15 aa |
| Standard deviation of domain lengths | 15.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A3H733 | 3-134 | SSPDSELHGCLLQLNSSARPWLIRDGATEGVDLVAEWKSDDPDWRQVLEDLAVALTFQIHLRLDAENRLLHAVDHLVEWRQDAEGQW… |
| A0A7U3VQT1 | 29-188 | ALYPVAGVPVRTPQDLWAALLALNDPARHPYTVRAGFADGADLVAEYRRVLRAYGTLTGRRRQECEEFQVRMWFDPAIHQVRSVDHM… |
| D1B6Q2 | 3-136 | None |
| A0A7J5VGA2 | 42-223 | None |
| A0A397RB45 | 18-166 | None |
| A0A3N1NB14 | 3-130 | None |
| K1E0B2 | 85-242 | None |
| A0A7V9I411 | 17-168 | None |
| A0A0G0BN40 | 1-146 | None |
| A0A1V5BJK2 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.