DPCstruct | MC13147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 324 |
|---|---|
| Mean domain length (aa) | 103 ± 19 aa |
| Standard deviation of domain lengths | 18.72 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.11 |
| Pfam Score | 99.24 |
| Assigned Pfam label(s) | PF00379- PF01683- CL0648- CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1XGA0 | 3-69 | LEYEYKYDVEDQEKTLYFGANEAGDAQGKVNGGYRVLLPDGRLMTVEYTVEGDSGFVPKISFESNAN |
| A0A1W4WVJ9 | 4-118 | LVVVLIVCIVYSAESSGVTIGIQSYSRPIEHQYYSQDALGSYVYGYITPHSTKTEFRTHDGVTKGGYSYIDPNGEVQTVEYTADAKN… |
| A0A6J1WCU2 | 8-142 | None |
| A0A7E5WI22 | 20-136 | None |
| A0A7E5WH44 | 73-176 | None |
| A0A5B7FC71 | 215-326 | None |
| A0A6J1WSM0 | 6-97 | None |
| T1KVK4 | 174-255 | None |
| A0A2P8ZAB6 | 356-451 | None |
| A0A0M3QVY7 | 134-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.