DPCstruct | MC13146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W4WIC6 | 15-103 | RNMAKVPDYTIYKIDEIPELKKVRDKLKKEGLCNPWLRNEAWRFNRKYFLTQRQRTFKLFARGFPLGAALTALTLGIEMMIGDEHGG… |
| Q4SNW8 | 3-83 | GDHGHGKISMPDWRQWKTEGTPLEFTQKRLAARGLKDPWARNEAWRYSGGFARAVTLSDVLFRGFKWGFAAFTVALAVEYA |
| W6UQ68 | 119-216 | None |
| A0A813PA38 | 34-126 | None |
| A0A5N5PCI5 | 37-119 | None |
| A0A452IJ92 | 144-235 | None |
| A0A6P6Q8D4 | 52-139 | None |
| A0A1W0X323 | 1-113 | None |
| A0A7J6YYX1 | 77-170 | None |
| A0A5J4N9K9 | 95-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.