DPCstruct | MC13145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0XI34 | 271-414 | KLYQRTLAGDFGIGIELLNSQKITVGPYIREDNVHLLELPKQMLYYSYTTVAAQRGWPVMEQLNHFILLANQHGLVLHWERRALRKN… |
| A0A1W4WI58 | 4-142 | EKLSYTRTFGYPTERLTGGHFSVPVFIKHDAIQHLRPMTEDIFWAYCIFMLKKSTPLLPSFNMLVLRVLEAGINYAWETKVVLFHTN… |
| A0A182HYH7 | 96-203 | None |
| A0A182JBJ4 | 166-285 | None |
| A0A2P8YH26 | 387-517 | None |
| A0A139WEQ4 | 210-332 | None |
| A0A6I8U448 | 2-140 | None |
| A0A7R9FBM3 | 116-258 | None |
| A0A811W550 | 344-466 | None |
| A0A084VA39 | 56-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.