DPCstruct | MC13141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9YN22 | 126-183 | RPTRTTSKPKPPPAPKTDPRFDTCKEANANGYGPYVEGEDPEYDWYQDRDGDGIVCER |
| A0A6P0HJH0 | 39-94 | SGSSGAGSSGSGSSGTDPHFGTCGEANANGYGDYVSGVDPEYDWYTDRDSDGIVCE |
| A0A6L9QPW8 | 7-62 | None |
| A0A1Q4B1I2 | 213-266 | None |
| A0A5C5BD29 | 104-150 | None |
| A0A5M3XB19 | 209-273 | None |
| A0A2W4J1S9 | 106-163 | None |
| A0A372GNM2 | 52-111 | None |
| A0A544Z9N9 | 101-157 | None |
| A0A1G9XN01 | 89-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.